PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G200700.1
Common NamePHAVU_008G200700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family SRS
Protein Properties Length: 348aa    MW: 36659.6 Da    PI: 8.3378
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G200700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702220.14.6e-681272873154
              DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklss 93 
                         sg+++CqdCGnqakkdC+ +RCRtCCksrgfdC thvkstWvpaa+rrerq +++a+ + a +s +++ +k++r   +++++++s+t++s+
  Phvul.008G200700.1 127 SGGTTCQDCGNQAKKDCTNRRCRTCCKSRGFDCPTHVKSTWVPAARRRERQLMTTATVAVAGSSGSTSGTKKPRLI-ASQTTTTSHTSTSN 216
                         7889************************************************999999999999999999999986.88899999****** PP

              DUF702  94 aeskkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                         ++++++++tss          lP +v+++avf+cvrv++v+dge+e+aYq++v+igGhvfkG+LydqG+e+
  Phvul.008G200700.1 217 TTPPRSFDTSSshqdagfkesLPGQVRAPAVFKCVRVTAVEDGEDEYAYQAVVKIGGHVFKGFLYDQGVEN 287
                         *********999********************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.3E-62129286IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.0E-27131173IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016245.3E-30238285IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MWPGTNRSIN YPEMGMFVVA PASSFHHHHH HQQPPPHDPV MADSLNPATA LGVGVIPLLA  60
TTPCLEPDNF LGNRTRGGGI QFWQDQTPHQ SHYMKKQQQQ GLLDQSNTSS GNLVQNSGGL  120
TASGTSSGGT TCQDCGNQAK KDCTNRRCRT CCKSRGFDCP THVKSTWVPA ARRRERQLMT  180
TATVAVAGSS GSTSGTKKPR LIASQTTTTS HTSTSNTTPP RSFDTSSSHQ DAGFKESLPG  240
QVRAPAVFKC VRVTAVEDGE DEYAYQAVVK IGGHVFKGFL YDQGVENRDV YPNLSELHLG  300
GGSGSGGSGG MGRNGVSSSP MMDPSDVYAA SGGGLLGGSS AYGNPMN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007141493.10.0hypothetical protein PHAVU_008G200700g
SwissprotQ94CK94e-85LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLV7B6F10.0V7B6F1_PHAVU; Uncharacterized protein
STRINGGLYMA02G44860.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.47e-71Lateral root primordium (LRP) protein-related